Lineage for d1jlva1 (1jlv A:85-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713031Protein Class delta GST [81355] (6 species)
    formerly a part of class theta enzymes
  7. 2713040Species Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId:123217] [74724] (1 PDB entry)
  8. 2713041Domain d1jlva1: 1jlv A:85-207 [71729]
    Other proteins in same PDB: d1jlva2, d1jlvb2, d1jlvc2, d1jlvd2, d1jlve2, d1jlvf2
    complexed with gsh

Details for d1jlva1

PDB Entry: 1jlv (more details), 1.75 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-3
PDB Compounds: (A:) glutathione transferase GST1-3

SCOPe Domain Sequences for d1jlva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}
kdpqkravvnqrlyfdmgtlyqrfadyyypqifakqpanaenekkmkdavdflntfldgh
kyvagdsltiadltvlatvstydvagfelakyphvaawyertrkeapgaaineagieefr
kyf

SCOPe Domain Coordinates for d1jlva1:

Click to download the PDB-style file with coordinates for d1jlva1.
(The format of our PDB-style files is described here.)

Timeline for d1jlva1: