Lineage for d1jkia1 (1jki A:9-322,A:438-533)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308735Protein Myo-inositol 1-phosphate synthase [75105] (2 species)
  7. 308736Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (8 PDB entries)
  8. 308749Domain d1jkia1: 1jki A:9-322,A:438-533 [71704]
    Other proteins in same PDB: d1jkia2, d1jkib2

Details for d1jkia1

PDB Entry: 1jki (more details), 2.2 Å

PDB Description: myo-Inositol-1-phosphate Synthase Complexed with an Inhibitor, 2-deoxy-glucitol-6-phosphate

SCOP Domain Sequences for d1jkia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkia1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
aehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvlt
flsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

SCOP Domain Coordinates for d1jkia1:

Click to download the PDB-style file with coordinates for d1jkia1.
(The format of our PDB-style files is described here.)

Timeline for d1jkia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jkia2