Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC homolog [54489] (4 species) gamma, delta T-cell ligand |
Species Human (Homo sapiens), Mic-b [TaxId:9606] [75380] (1 PDB entry) |
Domain d1je6a2: 1je6 A:0-180 [71639] Other proteins in same PDB: d1je6a1 complexed with so4 |
PDB Entry: 1je6 (more details), 2.5 Å
SCOPe Domain Sequences for d1je6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1je6a2 d.19.1.1 (A:0-180) Class I MHC homolog {Human (Homo sapiens), Mic-b [TaxId: 9606]} mephslrynlmvlsqdgsvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair r
Timeline for d1je6a2: