Lineage for d1je6a2 (1je6 A:0-180)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190594Protein MHC I homolog [54489] (3 species)
  7. 190598Species Human (Homo sapiens), Micb [TaxId:9606] [75380] (1 PDB entry)
  8. 190599Domain d1je6a2: 1je6 A:0-180 [71639]
    Other proteins in same PDB: d1je6a1

Details for d1je6a2

PDB Entry: 1je6 (more details), 2.5 Å

PDB Description: structure of the mhc class i homolog micb

SCOP Domain Sequences for d1je6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je6a2 d.19.1.1 (A:0-180) MHC I homolog {Human (Homo sapiens), Micb}
mephslrynlmvlsqdgsvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair
r

SCOP Domain Coordinates for d1je6a2:

Click to download the PDB-style file with coordinates for d1je6a2.
(The format of our PDB-style files is described here.)

Timeline for d1je6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1je6a1