Lineage for d1j9ib_ (1j9i B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150662Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 150663Superfamily a.6.1: Putative DNA-binding domain [46955] (5 families) (S)
  5. 150695Family a.6.1.5: Terminase gpNU1 subunit domain [74696] (1 protein)
  6. 150696Protein Terminase gpNU1 subunit domain [74697] (1 species)
  7. 150697Species Bacteriophage lambda [TaxId:10710] [74698] (1 PDB entry)
  8. 150699Domain d1j9ib_: 1j9i B: [71620]

Details for d1j9ib_

PDB Entry: 1j9i (more details)

PDB Description: structure of the dna binding domain of the gpnu1 subunit of lambda terminase

SCOP Domain Sequences for d1j9ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9ib_ a.6.1.5 (B:) Terminase gpNU1 subunit domain {Bacteriophage lambda}
mevnkkqladifgasirtiqnwqeqgmpvlrgggkgnevlydsaavikwyaerdaeiene
klrrevee

SCOP Domain Coordinates for d1j9ib_:

Click to download the PDB-style file with coordinates for d1j9ib_.
(The format of our PDB-style files is described here.)

Timeline for d1j9ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j9ia_