PDB entry 1j9i

View 1j9i on RCSB PDB site
Description: structure of the dna binding domain of the gpnu1 subunit of lambda terminase
Deposited on 2001-05-25, released 2002-08-14
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1j9ia_
  • Chain 'B':
    Domains in SCOP 1.61: d1j9ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j9iA (A:)
mevnkkqladifgasirtiqnwqeqgmpvlrgggkgnevlydsaavikwyaerdaeiene
klrrevee

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j9iB (B:)
mevnkkqladifgasirtiqnwqeqgmpvlrgggkgnevlydsaavikwyaerdaeiene
klrrevee