Lineage for d1j5et_ (1j5e T:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764036Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 764037Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 764038Protein Ribosomal protein S20 [46994] (2 species)
  7. 764066Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 764071Domain d1j5et_: 1j5e T: [71563]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5ev_
    complexed with unx, zn

Details for d1j5et_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d1j5et_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5et_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1j5et_:

Click to download the PDB-style file with coordinates for d1j5et_.
(The format of our PDB-style files is described here.)

Timeline for d1j5et_: