| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.7: Spectrin repeat-like [46965] (15 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() |
| Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
| Protein Ribosomal protein S20 [46994] (1 species) |
| Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries) |
| Domain d1j5et_: 1j5e T: [71563] Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5ev_ complexed with unx, zn |
PDB Entry: 1j5e (more details), 3.05 Å
SCOP Domain Sequences for d1j5et_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5et_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d1j5et_: