Lineage for d1j5ak_ (1j5a K:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206239Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 206240Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (6 PDB entries)
  8. 206512Domain d1j5ak_: 1j5a K: [71537]

Details for d1j5ak_

PDB Entry: 1j5a (more details), 3.5 Å

PDB Description: structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria

SCOP Domain Sequences for d1j5ak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ak_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOP Domain Coordinates for d1j5ak_:

Click to download the PDB-style file with coordinates for d1j5ak_.
(The format of our PDB-style files is described here.)

Timeline for d1j5ak_: