![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
![]() | Protein Proteasome beta subunit (catalytic) [56252] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [75567] (1 PDB entry) |
![]() | Domain d1iru1_: 1iru 1: [71350] Other proteins in same PDB: d1irua_, d1irub_, d1iruc_, d1irud_, d1irue_, d1iruf_, d1irug_, d1iruo_, d1irup_, d1iruq_, d1irur_, d1irus_, d1irut_, d1iruu_ |
PDB Entry: 1iru (more details), 2.75 Å
SCOP Domain Sequences for d1iru1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus)} rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi saaerdvytgdalricivtkegireetvslrkd
Timeline for d1iru1_:
![]() Domains from other chains: (mouse over for more information) d1iru2_, d1irua_, d1irub_, d1iruc_, d1irud_, d1irue_, d1iruf_, d1irug_, d1iruh_, d1irui_, d1iruj_, d1iruk_, d1irul_, d1irum_, d1irun_, d1iruo_, d1irup_, d1iruq_, d1irur_, d1irus_, d1irut_, d1iruu_, d1iruv_, d1iruw_, d1irux_, d1iruy_, d1iruz_ |