Lineage for d1icha_ (1ich A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154486Fold a.77: DEATH domain [47985] (1 superfamily)
  4. 154487Superfamily a.77.1: DEATH domain [47986] (1 family) (S)
  5. 154488Family a.77.1.1: DEATH domain [47987] (10 proteins)
  6. 154525Protein Tmor necrosis factor receptor-1 death domain [74741] (1 species)
  7. 154526Species Human (Homo sapiens) [TaxId:9606] [74742] (1 PDB entry)
  8. 154527Domain d1icha_: 1ich A: [71182]

Details for d1icha_

PDB Entry: 1ich (more details)

PDB Description: solution structure of the tumor necrosis factor receptor-1 death domain

SCOP Domain Sequences for d1icha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icha_ a.77.1.1 (A:) Tmor necrosis factor receptor-1 death domain {Human (Homo sapiens)}
patlyavvenvpplrwkefvkrlglsdheidrlelqngrclreaqysmlatwrrrtprre
atlellgrvlrdmdllgcledieealc

SCOP Domain Coordinates for d1icha_:

Click to download the PDB-style file with coordinates for d1icha_.
(The format of our PDB-style files is described here.)

Timeline for d1icha_: