PDB entry 1ich

View 1ich on RCSB PDB site
Description: solution structure of the tumor necrosis factor receptor-1 death domain
Deposited on 2001-04-01, released 2002-04-01
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-01, with a file datestamp of 2002-04-01.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1icha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ichA (A:)
  patlyavvenvpplrwkefvkrlglsdheidrlelqngrclreaqysmlatwrrrtprre
  atlellgrvlrdmdllgcledieealc