Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Proteus vulgaris [TaxId:585] [75596] (1 PDB entry) |
Domain d1hzob_: 1hzo B: [71093] complexed with mes |
PDB Entry: 1hzo (more details), 1.75 Å
SCOPe Domain Sequences for d1hzob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzob_ e.3.1.1 (B:) beta-Lactamase, class A {Proteus vulgaris [TaxId: 585]} ntieeqlntlekysqgrlgvalintednsqityrgeerfamastskvmavaavlkasekq aglldknitikksdlvayspitekhlttgmtlaelsaatlqysdntamnkildylggpak vtqfarsindvtyrldrkepelntaihgdprdttspiamakslqaltlgdalgqsqrqql vtwlkgnttgdnsikaglpkhwvvgdktgsgdygttndiaviwpenhaplilvvyftqqe qnakyrkdiiakaaeivtkeisns
Timeline for d1hzob_: