SCOPe 2.08: Domain d1hzob_: 1hzo B:

Lineage for d1hzob_ (1hzo B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Proteus vulgaris [TaxId:585] [75596] (1 PDB entry)

8. Domain d1hzob_: 1hzo B: [71093]
   complexed with mes

Details for d1hzob_

PDB Entry: 1hzo, 1.75 Å

PDB Description: structure of class a cephalosporinase from proteus vulgaris k1

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1hzob_:

Sequence; same for both SEQRES and ATOM records:

>d1hzob_ e.3.1.1 (B:) beta-Lactamase, class A {Proteus vulgaris [TaxId: 585]}
ntieeqlntlekysqgrlgvalintednsqityrgeerfamastskvmavaavlkasekq
aglldknitikksdlvayspitekhlttgmtlaelsaatlqysdntamnkildylggpak
vtqfarsindvtyrldrkepelntaihgdprdttspiamakslqaltlgdalgqsqrqql
vtwlkgnttgdnsikaglpkhwvvgdktgsgdygttndiaviwpenhaplilvvyftqqe
qnakyrkdiiakaaeivtkeisns

Timeline for d1hzob_:

• d1hzob_ first appeared in SCOP 1.61
  
• d1hzob_ appears in SCOPe 2.07