Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.128: Glutamine synthase/guanido kinase [55930] (1 superfamily) |
Superfamily d.128.1: Glutamine synthase/guanido kinase [55931] (2 families) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein) |
Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries) |
Domain d1htqk2: 1htq K:101-468 [71056] Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1 |
PDB Entry: 1htq (more details), 2.4 Å
SCOP Domain Sequences for d1htqk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htqk2 d.128.1.1 (K:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d1htqk2:
View in 3D Domains from other chains: (mouse over for more information) d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2 |