Lineage for d1htqc2 (1htq C:101-468)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261944Fold d.128: Glutamine synthase/guanido kinase [55930] (1 superfamily)
  4. 261945Superfamily d.128.1: Glutamine synthase/guanido kinase [55931] (2 families) (S)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  5. 261946Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)
  6. 261947Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 261948Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries)
  8. 261951Domain d1htqc2: 1htq C:101-468 [71040]
    Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1

Details for d1htqc2

PDB Entry: 1htq (more details), 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqc2 d.128.1.1 (C:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOP Domain Coordinates for d1htqc2:

Click to download the PDB-style file with coordinates for d1htqc2.
(The format of our PDB-style files is described here.)

Timeline for d1htqc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqc1
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2