Lineage for d1hpuc2 (1hpu C:26-362)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998110Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins)
  6. 2998111Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species)
  7. 2998112Species Escherichia coli [TaxId:562] [56309] (8 PDB entries)
    Uniprot P07024 26-550
  8. 2998117Domain d1hpuc2: 1hpu C:26-362 [70984]
    Other proteins in same PDB: d1hpua1, d1hpub1, d1hpuc1, d1hpud1
    complexed with a12, mn

Details for d1hpuc2

PDB Entry: 1hpu (more details), 1.85 Å

PDB Description: 5'-nucleotidase (closed form), complex with ampcp
PDB Compounds: (C:) 5'-nucleotidase

SCOPe Domain Sequences for d1hpuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpuc2 d.159.1.2 (C:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

SCOPe Domain Coordinates for d1hpuc2:

Click to download the PDB-style file with coordinates for d1hpuc2.
(The format of our PDB-style files is described here.)

Timeline for d1hpuc2: