Lineage for d1gx9a_ (1gx9 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324223Protein beta-Lactoglobulin [50827] (3 species)
  7. 1324224Species Cow (Bos taurus) [TaxId:9913] [50828] (39 PDB entries)
    Uniprot P02754
  8. 1324258Domain d1gx9a_: 1gx9 A: [70685]
    complexed with rea

Details for d1gx9a_

PDB Entry: 1gx9 (more details), 2.34 Å

PDB Description: bovine beta-lactoglobulin complexed with retinoic acid, trigonal lattice z
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d1gx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gx9a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d1gx9a_:

Click to download the PDB-style file with coordinates for d1gx9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gx9a_: