Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein beta-Lactoglobulin [50827] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [50828] (76 PDB entries) Uniprot P02754 |
Domain d1gx9a_: 1gx9 A: [70685] complexed with rea |
PDB Entry: 1gx9 (more details), 2.34 Å
SCOPe Domain Sequences for d1gx9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gx9a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
Timeline for d1gx9a_: