Lineage for d1gw9a_ (1gw9 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1149743Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1149788Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1149789Protein D-xylose isomerase [51666] (13 species)
  7. 1149917Species Streptomyces rubiginosus [TaxId:1929] [51670] (28 PDB entries)
  8. 1149927Domain d1gw9a_: 1gw9 A: [70658]
    complexed with ca, iod, lxc

Details for d1gw9a_

PDB Entry: 1gw9 (more details), 1.55 Å

PDB Description: tri-iodide derivative of xylose isomerase from streptomyces rubiginosus
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d1gw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw9a_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllga

SCOPe Domain Coordinates for d1gw9a_:

Click to download the PDB-style file with coordinates for d1gw9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gw9a_: