Lineage for d1gr7d_ (1gr7 D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369114Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 369144Protein Azurin [49530] (6 species)
  7. 369174Species Pseudomonas aeruginosa [TaxId:287] [49533] (33 PDB entries)
  8. 369180Domain d1gr7d_: 1gr7 D: [70384]
    complexed with cso, cu; mutant

Details for d1gr7d_

PDB Entry: 1gr7 (more details), 1.8 Å

PDB Description: crystal structure of the double mutant cys3ser/ser100pro from pseudomonas aeruginosa at 1.8 a resolution

SCOP Domain Sequences for d1gr7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gr7d_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
essvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
dgmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsalm
kgtltlk

SCOP Domain Coordinates for d1gr7d_:

Click to download the PDB-style file with coordinates for d1gr7d_.
(The format of our PDB-style files is described here.)

Timeline for d1gr7d_: