Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species) includes C-terminal additional subdomains |
Species Domestic pigeon (Columba livia) [TaxId:8932] [75116] (1 PDB entry) |
Domain d1gq2l1: 1gq2 L:280-580 [70330] Other proteins in same PDB: d1gq2a2, d1gq2b2, d1gq2c2, d1gq2d2, d1gq2e2, d1gq2f2, d1gq2g2, d1gq2h2, d1gq2i2, d1gq2j2, d1gq2k2, d1gq2l2, d1gq2m2, d1gq2n2, d1gq2o2, d1gq2p2 complexed with cl, mn, na, nap, oxl has additional subdomain(s) that are not in the common domain |
PDB Entry: 1gq2 (more details), 2.5 Å
SCOPe Domain Sequences for d1gq2l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gq2l1 c.2.1.7 (L:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} iqgtasvavagllaalritknrlsdhtvlfqgageaalgianlivmamqkegvskeeaik riwmvdskglivkgrasltpekehfahehcemknledivkdikptvligvaaiggaftqq ilqdmaafnkrpiifalsnptskaectaeqlykytegrgifasgspfdpvtlpsgqtlyp gqgnnsyvfpgvalgviscglkhigddvflttaeviaqevseenlqegrlypplvtiqqv slkiavriakeayrnntastypqpedleafirsqvystdyncfvadsytwpeeamkvk
Timeline for d1gq2l1:
View in 3D Domains from other chains: (mouse over for more information) d1gq2a1, d1gq2a2, d1gq2b1, d1gq2b2, d1gq2c1, d1gq2c2, d1gq2d1, d1gq2d2, d1gq2e1, d1gq2e2, d1gq2f1, d1gq2f2, d1gq2g1, d1gq2g2, d1gq2h1, d1gq2h2, d1gq2i1, d1gq2i2, d1gq2j1, d1gq2j2, d1gq2k1, d1gq2k2, d1gq2m1, d1gq2m2, d1gq2n1, d1gq2n2, d1gq2o1, d1gq2o2, d1gq2p1, d1gq2p2 |