Lineage for d1gq2j1 (1gq2 J:280-580)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106264Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2106424Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
    includes C-terminal additional subdomains
  7. 2106425Species Domestic pigeon (Columba livia) [TaxId:8932] [75116] (1 PDB entry)
  8. 2106435Domain d1gq2j1: 1gq2 J:280-580 [70326]
    Other proteins in same PDB: d1gq2a2, d1gq2b2, d1gq2c2, d1gq2d2, d1gq2e2, d1gq2f2, d1gq2g2, d1gq2h2, d1gq2i2, d1gq2j2, d1gq2k2, d1gq2l2, d1gq2m2, d1gq2n2, d1gq2o2, d1gq2p2
    complexed with cl, mn, na, nap, oxl

Details for d1gq2j1

PDB Entry: 1gq2 (more details), 2.5 Å

PDB Description: malic enzyme from pigeon liver
PDB Compounds: (J:) malic enzyme

SCOPe Domain Sequences for d1gq2j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq2j1 c.2.1.7 (J:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]}
iqgtasvavagllaalritknrlsdhtvlfqgageaalgianlivmamqkegvskeeaik
riwmvdskglivkgrasltpekehfahehcemknledivkdikptvligvaaiggaftqq
ilqdmaafnkrpiifalsnptskaectaeqlykytegrgifasgspfdpvtlpsgqtlyp
gqgnnsyvfpgvalgviscglkhigddvflttaeviaqevseenlqegrlypplvtiqqv
slkiavriakeayrnntastypqpedleafirsqvystdyncfvadsytwpeeamkvk

SCOPe Domain Coordinates for d1gq2j1:

Click to download the PDB-style file with coordinates for d1gq2j1.
(The format of our PDB-style files is described here.)

Timeline for d1gq2j1: