Lineage for d1gpza2 (1gpz A:290-357)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638800Protein Complement C1R protease domains [75682] (1 species)
  7. 2638801Species Human (Homo sapiens) [TaxId:9606] [75683] (3 PDB entries)
  8. 2638804Domain d1gpza2: 1gpz A:290-357 [70303]
    Other proteins in same PDB: d1gpza1, d1gpzb1
    complexed with fuc, man, nag

Details for d1gpza2

PDB Entry: 1gpz (more details), 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r
PDB Compounds: (A:) complement c1r component

SCOPe Domain Sequences for d1gpza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
amprckik

SCOPe Domain Coordinates for d1gpza2:

Click to download the PDB-style file with coordinates for d1gpza2.
(The format of our PDB-style files is described here.)

Timeline for d1gpza2: