Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Domain d1gpza1: 1gpz A:434-685 [70302] Other proteins in same PDB: d1gpza2, d1gpza3, d1gpzb2, d1gpzb3 complexed with nag |
PDB Entry: 1gpz (more details), 2.9 Å
SCOPe Domain Sequences for d1gpza1:
Sequence, based on SEQRES records: (download)
>d1gpza1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehe aqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlg pnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrm dvfsqnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkv lnyvdwikkeme
>d1gpza1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeha sldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllp iclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqacensqnmfcaghpslkqdacq gdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkeme
Timeline for d1gpza1: