Lineage for d1gpza1 (1gpz A:434-685)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167950Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)
  6. 168078Protein Complement C1R protease, catalytic domain [74976] (1 species)
  7. 168079Species Human (Homo sapiens) [TaxId:9606] [74977] (1 PDB entry)
  8. 168080Domain d1gpza1: 1gpz A:434-685 [70302]
    Other proteins in same PDB: d1gpza2, d1gpza3, d1gpzb2, d1gpzb3

Details for d1gpza1

PDB Entry: 1gpz (more details), 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r

SCOP Domain Sequences for d1gpza1:

Sequence, based on SEQRES records: (download)

>d1gpza1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens)}
cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehe
aqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlg
pnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrm
dvfsqnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkv
lnyvdwikkeme

Sequence, based on observed residues (ATOM records): (download)

>d1gpza1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens)}
cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeha
sldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllp
iclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqacensqnmfcaghpslkqdacq
gdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkeme

SCOP Domain Coordinates for d1gpza1:

Click to download the PDB-style file with coordinates for d1gpza1.
(The format of our PDB-style files is described here.)

Timeline for d1gpza1: