SCOPe 2.06: Domain d1go4a_: 1go4 A:

Lineage for d1go4a_ (1go4 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
   core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213

4. Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families)
   N- and C-termini undergo large conformational rearrangement upon ligand binding
   automatically mapped to Pfam PF02301

5. Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)

6. Protein The spindle assembly checkpoint protein mad2 [56021] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries)

8. Domain d1go4a_: 1go4 A: [70292]
   Other proteins in same PDB: d1go4e_, d1go4f_, d1go4g_, d1go4h_
   complex with mad1

Details for d1go4a_

PDB Entry: 1go4, 2.05 Å

PDB Description: crystal structure of mad1-mad2 reveals a conserved mad2 binding motif in mad1 and cdc20.

PDB Compounds: (A:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d1go4a_:

Sequence; same for both SEQRES and ATOM records:

>d1go4a_ d.135.1.1 (A:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]}
eqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnn
vveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqde
irsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsft
ttihkvnsmvaykipv

Timeline for d1go4a_:

• d1go4a_ first appeared in SCOP 1.61
  
• d1go4a_ appears in SCOPe 2.05
  
• d1go4a_ appears in SCOPe 2.07
  
• d1go4a_ appears in the current release, SCOPe 2.08