Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
Protein Thermosome, A-domain [52035] (4 species) |
Species Mouse (Mus musculus), gamma chain [TaxId:10090] [75137] (2 PDB entries) |
Domain d1gn1d_: 1gn1 D: [70280] apical domain only complexed with ca |
PDB Entry: 1gn1 (more details), 2.8 Å
SCOPe Domain Sequences for d1gn1d_:
Sequence, based on SEQRES records: (download)
>d1gn1d_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} vlrgvminkdvthprmrryiknprivlldssleykkgesqtdieitreedftrilqmeee yihqlcediiqlkpdvvitekgisdlaqhylmranvtairrvrktdnnriaracgarivs rpeelreddvgtgaglleikkigdeyftfitdckdpkactillrg
>d1gn1d_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} vlrgvminkdvthprmrryiknprivlldssleyilqmeeeyihqlcediiqlkpdvvit ekgisdlaqhylmranvtairrvrktdnnriaracgarivsrpeelreddvgtgagllei kkigdeyftfitdckdpkactillrg
Timeline for d1gn1d_: