Lineage for d1gkpc2 (1gkp C:55-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833715Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
    automatically mapped to Pfam PF13147
  6. 2833716Protein D-hydantoinase [75074] (4 species)
  7. 2833734Species Thermus sp. [TaxId:275] [75075] (2 PDB entries)
  8. 2833737Domain d1gkpc2: 1gkp C:55-389 [70236]
    Other proteins in same PDB: d1gkpa1, d1gkpb1, d1gkpc1, d1gkpd1, d1gkpe1, d1gkpf1
    complexed with epe, so4, zn

Details for d1gkpc2

PDB Entry: 1gkp (more details), 1.3 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group c2221
PDB Compounds: (C:) hydantoinase

SCOPe Domain Sequences for d1gkpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkpc2 c.1.9.6 (C:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]}
fidphvhiylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskae
gnsycdytfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlak
elgvivtahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgat
gyvvhlsckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdk
rnqkvlwdalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvs
rgrldihrfvdaastkaaklfglfprkgtiavgsd

SCOPe Domain Coordinates for d1gkpc2:

Click to download the PDB-style file with coordinates for d1gkpc2.
(The format of our PDB-style files is described here.)

Timeline for d1gkpc2: