SCOP 1.61: Domain d1ea9c1: 1ea9 C:1-121

Lineage for d1ea9c1 (1ea9 C:1-121)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Maltogenic amylase, N-terminal domain [49221] (4 species)

7. Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [74842] (1 PDB entry)

8. Domain d1ea9c1: 1ea9 C:1-121 [70087]
   Other proteins in same PDB: d1ea9c2, d1ea9c3, d1ea9d2, d1ea9d3

Details for d1ea9c1

PDB Entry: 1ea9, 3.2 Å

PDB Description: cyclomaltodextrinase

SCOP Domain Sequences for d1ea9c1:

Sequence; same for both SEQRES and ATOM records:

>d1ea9c1 b.1.1.5 (C:1-121) Maltogenic amylase, N-terminal domain {Bacillus sp., cyclomaltodextrinase}
mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla
tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd
v

Timeline for d1ea9c1:

• d1ea9c1 is new in SCOP 1.61
  
• d1ea9c1 appears in SCOP 1.63
  
• d1ea9c1 appears in the current release, SCOPe 2.08