SCOPe 2.08: Domain d1ea9c1: 1ea9 C:1-121

Lineage for d1ea9c1 (1ea9 C:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [74842] (1 PDB entry)

8. Domain d1ea9c1: 1ea9 C:1-121 [70087]
   Other proteins in same PDB: d1ea9c2, d1ea9c3, d1ea9d2, d1ea9d3
   has additional insertions and/or extensions that are not grouped together

Details for d1ea9c1

PDB Entry: 1ea9, 3.2 Å

PDB Description: cyclomaltodextrinase

PDB Compounds: (C:) cyclomaltodextrinase

SCOPe Domain Sequences for d1ea9c1:

Sequence; same for both SEQRES and ATOM records:

>d1ea9c1 b.1.18.2 (C:1-121) Maltogenic amylase, N-terminal domain N {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla
tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd
v

Timeline for d1ea9c1:

• d1ea9c1 first appeared in SCOP 1.61
  
• d1ea9c1 appears in SCOPe 2.07