Lineage for d1kpsb_ (1kps B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155820Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies)
  4. 156099Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
  5. 156100Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (1 protein)
  6. 156101Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (1 species)
  7. 156102Species Mouse (Mus musculus) [TaxId:10090] [69102] (1 PDB entry)
  8. 156103Domain d1kpsb_: 1kps B: [68787]
    Other proteins in same PDB: d1kpsa_, d1kpsc_

Details for d1kpsb_

PDB Entry: 1kps (more details), 2.5 Å

PDB Description: structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1

SCOP Domain Sequences for d1kpsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpsb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus)}
tdlstflsfpspekllrlgpkvsvlivqqtdtsdpekvvsaflkvasvfrddasvktavl
daidalmkkafscssfnsntfltrllihmgllksedkikaipslhgplmvlnhvvrqdyf
pkalaplllafvtkpngaletcsfarhnllqtlyni

SCOP Domain Coordinates for d1kpsb_:

Click to download the PDB-style file with coordinates for d1kpsb_.
(The format of our PDB-style files is described here.)

Timeline for d1kpsb_: