Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) |
Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) |
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) |
Protein Ubiquitin conjugating enzyme [54497] (13 species) |
Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (4 PDB entries) |
Domain d1kpsa_: 1kps A: [68786] Other proteins in same PDB: d1kpsb_, d1kpsd_ |
PDB Entry: 1kps (more details), 2.5 Å
SCOP Domain Sequences for d1kpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpsa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubc9} smsgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfk lrmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqel lnepniqdpaqaeaytiycqnrveyekrvraqakkfaps
Timeline for d1kpsa_: