Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein) |
Protein mRNA export factor tap [54955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries) |
Domain d1kooc2: 1koo C:101-200 [68730] Other proteins in same PDB: d1kooa1, d1koob_, d1kooc1, d1kood_ mutant |
PDB Entry: 1koo (more details), 3.8 Å
SCOP Domain Sequences for d1kooc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kooc2 d.58.7.2 (C:101-200) mRNA export factor tap {Human (Homo sapiens)} apperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhyentraq ffvedastasalkavnykildrenrrisiiinssapphti
Timeline for d1kooc2:
View in 3D Domains from other chains: (mouse over for more information) d1kooa1, d1kooa2, d1koob_, d1kood_ |