Lineage for d1kooa2 (1koo A:105-200)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192276Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 192380Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 192381Protein mRNA export factor tap [54955] (1 species)
  7. 192382Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 192385Domain d1kooa2: 1koo A:105-200 [68727]
    Other proteins in same PDB: d1kooa1, d1koob1, d1kooc1, d1kood1

Details for d1kooa2

PDB Entry: 1koo (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor

SCOP Domain Sequences for d1kooa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kooa2 d.58.7.2 (A:105-200) mRNA export factor tap {Human (Homo sapiens)}
rggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffve
dastasalkavnykildrenrrisiiinssapphti

SCOP Domain Coordinates for d1kooa2:

Click to download the PDB-style file with coordinates for d1kooa2.
(The format of our PDB-style files is described here.)

Timeline for d1kooa2: