PDB entry 1koo

View 1koo on RCSB PDB site
Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor
Deposited on 2001-12-21, released 2002-02-27
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.317
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kooA (A:)
    rggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffve
    dastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlklimskrydgsq
    qaldlkglrsdpdlvaqnidvvlnrrssmaatlriieenipellslnlsnnrlyrlddms
    sivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqstyisairer
    fpkllrldghelpppiaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kooB (B:)
    elkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlriiee
    nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
    dgnslcdtfrdqstyisairerfpkllrldghelpppiafdveap
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kooC (C:)
    apperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhyentraq
    ffvedastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlklimskry
    dgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlriieenipellslnlsnnrlyrl
    ddmssivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqstyisa
    irerfpkllrldghelpppiaf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kooD (D:)
    lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlriieen
    ipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwld
    gnslcdtfrdqstyisairerfpkllrldghelpppiafdveapttlpp