SCOP 1.61: Domain d1kohd1: 1koh D:

Lineage for d1kohd1 (1koh D:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)

4. Superfamily c.10.2: L domain-like [52058] (7 families)

5. Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
   this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain

6. Protein mRNA export factor tap [52066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)

8. Domain d1kohd1: 1koh D: [68724]
   Other proteins in same PDB: d1koha2, d1kohc2

Details for d1kohd1

PDB Entry: 1koh, 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor

SCOP Domain Sequences for d1kohd1:

Sequence; same for both SEQRES and ATOM records:

>d1kohd1 c.10.2.3 (D:) mRNA export factor tap {Human (Homo sapiens)}
lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii
eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel
wldgnslsdtfrdqstyisairerfpkllrldghelpppiafdveapttlpp

Timeline for d1kohd1:

• d1kohd1 first appeared in SCOP 1.59
  
• d1kohd1 is called d1kohd_ in SCOP 1.63
  
• d1kohd1 appears in the current release, SCOPe 2.08, called d1kohd_