Lineage for d1kkcx2 (1kkc X:98-214)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946133Species Aspergillus fumigatus [TaxId:5085] [69693] (1 PDB entry)
  8. 2946136Domain d1kkcx2: 1kkc X:98-214 [68665]
    Other proteins in same PDB: d1kkca1, d1kkcb1, d1kkcx1, d1kkcy1
    complexed with mn

Details for d1kkcx2

PDB Entry: 1kkc (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus MnSOD
PDB Compounds: (X:) manganese superoxide dismutase

SCOPe Domain Sequences for d1kkcx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkcx2 d.44.1.1 (X:98-214) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]}
eksgggkidqapvlkaaieqrwgsfdkfkdafnttllgiqgsgwgwlvtdgpkgklditt
thdqdpvtgaapvfgvdmwehayylqylndkasyakgiwnvinwaeaenryiagdkg

SCOPe Domain Coordinates for d1kkcx2:

Click to download the PDB-style file with coordinates for d1kkcx2.
(The format of our PDB-style files is described here.)

Timeline for d1kkcx2: