Lineage for d1kkcb1 (1kkc B:15-97)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904342Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 904343Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 904469Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 904473Species Aspergillus fumigatus [TaxId:5085] [68944] (1 PDB entry)
  8. 904475Domain d1kkcb1: 1kkc B:15-97 [68662]
    Other proteins in same PDB: d1kkca2, d1kkcb2, d1kkcx2, d1kkcy2
    complexed with mn

Details for d1kkcb1

PDB Entry: 1kkc (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus MnSOD
PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1kkcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkcb1 a.2.11.1 (B:15-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]}
qytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvsv
qqaikfnggghinhslfwknlap

SCOPe Domain Coordinates for d1kkcb1:

Click to download the PDB-style file with coordinates for d1kkcb1.
(The format of our PDB-style files is described here.)

Timeline for d1kkcb1: