Lineage for d1kjwa1 (1kjw A:430-525)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783735Protein Psd-95 [69248] (1 species)
    associates with a guanylate kinase domain
  7. 1783736Species Norway rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries)
  8. 1783737Domain d1kjwa1: 1kjw A:430-525 [68643]
    Other proteins in same PDB: d1kjwa2
    complexed with so4

Details for d1kjwa1

PDB Entry: 1kjw (more details), 1.8 Å

PDB Description: sh3-guanylate kinase module from psd-95
PDB Compounds: (A:) postsynaptic density protein 95

SCOPe Domain Sequences for d1kjwa1:

Sequence, based on SEQRES records: (download)

>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet

Sequence, based on observed residues (ATOM records): (download)

>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkwgsssgsqgredsvlsyet

SCOPe Domain Coordinates for d1kjwa1:

Click to download the PDB-style file with coordinates for d1kjwa1.
(The format of our PDB-style files is described here.)

Timeline for d1kjwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjwa2