Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins) contains a catalytic Cys-His-Glu triad |
Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species) |
Species Escherichia coli [TaxId:562] [52322] (9 PDB entries) |
Domain d1keeb2: 1kee B:153-380 [68499] Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1 |
PDB Entry: 1kee (more details), 2.1 Å
SCOP Domain Sequences for d1keeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keeb2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli} lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt
Timeline for d1keeb2:
View in 3D Domains from other chains: (mouse over for more information) d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keed2, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1, d1keeh2 |