SCOPe 2.05: Domain d1k7ad_: 1k7a D:

Lineage for d1k7ad_ (1k7a D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46863] (6 PDB entries)
   Uniprot P27577 301-440

8. Domain d1k7ad_: 1k7a D: [68265]
   protein/DNA complex

Details for d1k7ad_

PDB Entry: 1k7a, 2.8 Å

PDB Description: Ets-1(331-440)+GGAG duplex

PDB Compounds: (D:) c-ets-1 protein

SCOPe Domain Sequences for d1k7ad_:

Sequence; same for both SEQRES and ATOM records:

>d1k7ad_ a.4.5.21 (D:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus) [TaxId: 10090]}
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

Timeline for d1k7ad_:

• d1k7ad_ first appeared in SCOP 1.59
  
• d1k7ad_ appears in SCOPe 2.04
  
• d1k7ad_ appears in SCOPe 2.06
  
• d1k7ad_ appears in the current release, SCOPe 2.08