Lineage for d1k5gj_ (1k5g J:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830580Protein Ran [52609] (2 species)
  7. 830595Species Human (Homo sapiens) [TaxId:9606] [52611] (7 PDB entries)
  8. 830610Domain d1k5gj_: 1k5g J: [68189]
    Other proteins in same PDB: d1k5gb_, d1k5gc_, d1k5ge_, d1k5gf_, d1k5gh_, d1k5gi_, d1k5gk_, d1k5gl_
    complexed with af3, gdp, mg; mutant

Details for d1k5gj_

PDB Entry: 1k5g (more details), 3.1 Å

PDB Description: Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex
PDB Compounds: (J:) GTP-binding nuclear protein ran

SCOP Domain Sequences for d1k5gj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5gj_ c.37.1.8 (J:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpded

SCOP Domain Coordinates for d1k5gj_:

Click to download the PDB-style file with coordinates for d1k5gj_.
(The format of our PDB-style files is described here.)

Timeline for d1k5gj_: