![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Ran [52609] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52611] (7 PDB entries) |
![]() | Domain d1k5ga_: 1k5g A: [68180] Other proteins in same PDB: d1k5gb_, d1k5gc_, d1k5ge_, d1k5gf_, d1k5gh_, d1k5gi_, d1k5gk_, d1k5gl_ |
PDB Entry: 1k5g (more details), 3.1 Å
SCOP Domain Sequences for d1k5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5ga_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev vmdpalaaqyehdlevaqttalpded
Timeline for d1k5ga_: