Lineage for d1k51a_ (1k51 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894775Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1894776Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1894777Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 1894778Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 1894786Domain d1k51a_: 1k51 A: [68147]
    b1 domain; mutation-induced segment swapping
    complexed with zn; mutant

Details for d1k51a_

PDB Entry: 1k51 (more details), 1.8 Å

PDB Description: a g55a mutation induces 3d domain swapping in the b1 domain of protein l from peptostreptococcus magnus
PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d1k51a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k51a_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
dkaytlnikfag

SCOPe Domain Coordinates for d1k51a_:

Click to download the PDB-style file with coordinates for d1k51a_.
(The format of our PDB-style files is described here.)

Timeline for d1k51a_: