Lineage for d1k4ca1 (1k4c A:6-118)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353188Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2353234Domain d1k4ca1: 1k4c A:6-118 [68126]
    Other proteins in same PDB: d1k4ca2, d1k4ca3, d1k4cb1, d1k4cb2, d1k4cc_
    part of Fab against potassium channel KcsA
    complexed with dga, f09, k

Details for d1k4ca1

PDB Entry: 1k4c (more details), 2 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of k+
PDB Compounds: (A:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d1k4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4ca1 b.1.1.1 (A:6-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss

SCOPe Domain Coordinates for d1k4ca1:

Click to download the PDB-style file with coordinates for d1k4ca1.
(The format of our PDB-style files is described here.)

Timeline for d1k4ca1: