Lineage for d1k4ca1 (1k4c A:1-118)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102518Species Fab against potassium channel KcsA, (mouse), kappa L chain [69140] (2 PDB entries)
  8. 102519Domain d1k4ca1: 1k4c A:1-118 [68126]
    Other proteins in same PDB: d1k4ca2, d1k4cb2, d1k4cc_

Details for d1k4ca1

PDB Entry: 1k4c (more details), 2 Å

PDB Description: Potassium Channel KcsA-Fab complex in high concentration of K+
PDB Compounds: (A:)

SCOP Domain Sequences for d1k4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4ca1 b.1.1.1 (A:1-118) Immunoglobulin (variable domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss

SCOP Domain Coordinates for d1k4ca1:

Click to download the PDB-style file with coordinates for d1k4ca1.
(The format of our PDB-style files is described here.)

Timeline for d1k4ca1: