Lineage for d1k32a1 (1k32 A:763-853)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228215Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 228216Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 228270Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 228277Protein Tricorn protease [69253] (1 species)
  7. 228278Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)
  8. 228279Domain d1k32a1: 1k32 A:763-853 [68068]
    Other proteins in same PDB: d1k32a2, d1k32a3, d1k32a4, d1k32b2, d1k32b3, d1k32b4, d1k32c2, d1k32c3, d1k32c4, d1k32d2, d1k32d3, d1k32d4, d1k32e2, d1k32e3, d1k32e4, d1k32f2, d1k32f3, d1k32f4

Details for d1k32a1

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease

SCOP Domain Sequences for d1k32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

SCOP Domain Coordinates for d1k32a1:

Click to download the PDB-style file with coordinates for d1k32a1.
(The format of our PDB-style files is described here.)

Timeline for d1k32a1: