SCOPe 2.02: Domain d1k1ja_: 1k1j A:

Lineage for d1k1ja_ (1k1j A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d1k1ja_: 1k1j A: [68017]
   complexed with ca, fd2, so4

Details for d1k1ja_

PDB Entry: 1k1j, 2.2 Å

PDB Description: bovine trypsin-inhibitor complex

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1k1ja_:

Sequence; same for both SEQRES and ATOM records:

>d1k1ja_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1k1ja_:

• d1k1ja_ first appeared in SCOP 1.59
  
• d1k1ja_ appears in SCOPe 2.01
  
• d1k1ja_ appears in SCOPe 2.03
  
• d1k1ja_ appears in the current release, SCOPe 2.08