SCOPe 2.01: Domain d1jzkd_: 1jzk D:

Lineage for d1jzkd_ (1jzk D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (35 PDB entries)

8. Domain d1jzkd_: 1jzk D: [67864]
   complexed with hem; mutant

Details for d1jzkd_

PDB Entry: 1jzk, 2.2 Å

PDB Description: crystal structure of scapharca inaequivalvis hbi, i114f mutant (deoxy)

PDB Compounds: (D:) Globin I - Ark Shell

SCOPe Domain Sequences for d1jzkd_:

Sequence; same for both SEQRES and ATOM records:

>d1jzkd_ a.1.1.2 (D:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkfngpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d1jzkd_:

• d1jzkd_ first appeared in SCOP 1.59
  
• d1jzkd_ appears in SCOP 1.75
  
• d1jzkd_ appears in SCOPe 2.02
  
• d1jzkd_ appears in the current release, SCOPe 2.08