Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) |
Domain d1jz8b2: 1jz8 B:626-730 [67836] Other proteins in same PDB: d1jz8a3, d1jz8a4, d1jz8a5, d1jz8b3, d1jz8b4, d1jz8b5, d1jz8c3, d1jz8c4, d1jz8c5, d1jz8d3, d1jz8d4, d1jz8d5 |
PDB Entry: 1jz8 (more details), 1.5 Å
SCOP Domain Sequences for d1jz8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz8b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jz8b2:
View in 3D Domains from same chain: (mouse over for more information) d1jz8b1, d1jz8b3, d1jz8b4, d1jz8b5 |